information

Whoever comes in this website may find a hint

Phage therapy is influenced by:

Phage therapy is influenced by:

Country :
the epidemiological situation is different from country to country in terms of circulating bacteria and bacteriophages. Example: a lytic phages from Italy may be no active on the same bacteria (genus and species) isolated from another country and vice versa.
Chronolability
Mutation rate
Phenotypical delay
Phage cocktail
My point of view

From Wikipedia


If the target host* of a phage therapy treatment is not
an animal the term "
biocontrol" (as in phage-mediated biocontrol of bacteria) is usually employed, rather than "phage therapy".

"In silico"

From:"Genomics,Proteomics and Clinical Bacteriology", N.Woodford and Alan P.Johnson

Phrase that emphasizes the fact that many molecular biologists spend increasing amounts of their time in front of a computer screen, generating hypotheses that can subsequently be tested and (hopefully) confirmed in the laboratory.

Saturday, 23 August 2014

Crystal Structure Of Lysin B From Mycobacteriophage D29.

Is gp12 D29p09


 From NCBI links:

" LysB of mycobacteriophage D29 is a novel mycolylarabinogalactan esterase that cleaves the ester linkage joining the mycolic acid-rich outer membrane to arabinogalactan, releasing free mycolic acids".

go to :
 D29p02
1
2
3
4

primary structure gp 12 protein (254 Aa) :




"MSKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAEL
ILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPM
RQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYE
VAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPH
LYNRYPAVEFLRQI"


From
PDB Protein Data Bank:

 1) download files:FASTA Sequence, PDB File (Text)

2) examine the protein by mEmboss software




3) if there are the transmembrane regions use MPEX software and Geneious

 


4)Download the protein file PDB in a Protein viewer software and to observe

 This is NBCI model.


These protein models are mine:


 
by Discovery Studio 4.0